| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Apoptosis regulator Bcl-2 |
|---|
| Ligand | BDBM179598 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Surface plasmon resonance (SPR) |
|---|
| IC50 | 726.275±n/a nM |
|---|
| Citation |  Visser, MS; Yusuff, N Compounds for inhibiting the interaction of BCL2 with binding partners US Patent US9126980 Publication Date 9/8/2015 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Apoptosis regulator Bcl-2 |
|---|
| Name: | Apoptosis regulator Bcl-2 |
|---|
| Synonyms: | Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | BCL2 | BCL2_HUMAN | Bcl-2 Protein |
|---|
| Type: | Homodimer or heterodimer |
|---|
| Mol. Mass.: | 26269.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P10415 |
|---|
| Residue: | 239 |
|---|
| Sequence: | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
|
|
|
|---|
| BDBM179598 |
|---|
| n/a |
|---|
| Name | BDBM179598 |
|---|
| Synonyms: | US9126980, 43 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C40H53N5O5S |
|---|
| Mol. Mass. | 715.944 |
|---|
| SMILES | CCCCN(CCCC)C(=O)c1cc(C)n(n1)-c1ccc(NS(=O)C[C@]23CC[C@H](CC2=O)C3(C)C)cc1C(=O)N1Cc2ccccc2C[C@H]1CO |r,THB:31:30:27.26:32| |
|---|
| Structure | 
|
|---|
Search and Browse
