| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ |
|---|
| Ligand | BDBM24777 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | FabZ Inhibition Assay |
|---|
| pH | 7±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | 5.4e+3± 1.4e+3 nM |
|---|
| Comments | extracted |
|---|
| Citation |  McGillick, BE; Kumaran, D; Vieni, C; Swaminathan, S ß-Hydroxyacyl-acyl Carrier Protein Dehydratase (FabZ) from Francisella tularensis and Yersinia pestis: Structure Determination, Enzymatic Characterization, and Cross-Inhibition Studies. Biochemistry55:1091-9 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ |
|---|
| Name: | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ |
|---|
| Synonyms: | beta-Hydroxyacyl-acyl carrier protein dehydratase (FtFabZ) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 18151.57 |
|---|
| Organism: | Francisella tularensis |
|---|
| Description: | n/a |
|---|
| Residue: | 163 |
|---|
| Sequence: | MSQFNQNNKQIDVMGIRKILPHRYPFALLDKIVDWSVEDRTIVAQKNVTINEDFFNGHFP
DFPVMPGVLIVEAMAQATAILGELMAETLFAHVVEKAGGGRRTFMLAGIDKVRVKRPVVP
GDVLVIESRMVKQKNIICTAESVAKVDGQIVCSAELMAAYKDY
|
|
|
|---|
| BDBM24777 |
|---|
| n/a |
|---|
| Name | BDBM24777 |
|---|
| Synonyms: | 5-hydroxy-1,4-dihydronaphthalene-1,4-dione | 5-hydroxy-1,4-naphthoquinone, 4 | CHEMBL43612 | Juglone | Juglone (6a) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H6O3 |
|---|
| Mol. Mass. | 174.1528 |
|---|
| SMILES | Oc1cccc2C(=O)C=CC(=O)c12 |c:8| |
|---|
| Structure | 
|
|---|
Search and Browse
