Reaction Details |
| Report a problem with these data |
Target | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ |
---|
Ligand | BDBM24777 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | FabZ Inhibition Assay |
---|
pH | 7±n/a |
---|
Temperature | 298.15±n/a K |
---|
IC50 | 5.4e+3± 1.4e+3 nM |
---|
Comments | extracted |
---|
Citation | McGillick, BE; Kumaran, D; Vieni, C; Swaminathan, S ß-Hydroxyacyl-acyl Carrier Protein Dehydratase (FabZ) from Francisella tularensis and Yersinia pestis: Structure Determination, Enzymatic Characterization, and Cross-Inhibition Studies. Biochemistry55:1091-9 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ |
---|
Name: | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ |
Synonyms: | beta-Hydroxyacyl-acyl carrier protein dehydratase (FtFabZ) |
Type: | Protein |
Mol. Mass.: | 18151.57 |
Organism: | Francisella tularensis |
Description: | n/a |
Residue: | 163 |
Sequence: | MSQFNQNNKQIDVMGIRKILPHRYPFALLDKIVDWSVEDRTIVAQKNVTINEDFFNGHFP
DFPVMPGVLIVEAMAQATAILGELMAETLFAHVVEKAGGGRRTFMLAGIDKVRVKRPVVP
GDVLVIESRMVKQKNIICTAESVAKVDGQIVCSAELMAAYKDY
|
|
|
BDBM24777 |
---|
n/a |
---|
Name | BDBM24777 |
Synonyms: | 5-hydroxy-1,4-dihydronaphthalene-1,4-dione | 5-hydroxy-1,4-naphthoquinone, 4 | CHEMBL43612 | Juglone | Juglone (6a) |
Type | Small organic molecule |
Emp. Form. | C10H6O3 |
Mol. Mass. | 174.1528 |
SMILES | Oc1cccc2C(=O)C=CC(=O)c12 |c:8| |
Structure |
|