| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bcl-2-like protein 1 |
|---|
| Ligand | BDBM185615 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Time Resolved-Fluorescence Resonance Energy Transfer (TR-FRET) Assay |
|---|
| Temperature | 298.15±n/a K |
|---|
| Ki | 393.356±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Kunzer, AR; Elmore, SW; Hexamer, LA; Park, C; Souers, AJ; Sullivan, GM; Wang, GT; Wang, X; Wendt, MD Apoptosis-inducing agents for the treatment of cancer and immune and autoimmune diseases US Patent US9156856 Publication Date 10/13/2015 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bcl-2-like protein 1 |
|---|
| Name: | Bcl-2-like protein 1 |
|---|
| Synonyms: | Anti-apoptotic Bcl-2 protein | Apoptosis Regulator Bcl-xL | Apoptosis regulator Bcl-X | B2CL1_HUMAN | BCL2-like 1 isoform 1 | BCL2L | BCL2L1 | BCLX | Bcl-2-like protein 1 (Bcl-XL) | Bcl-X | Bcl-xL/Bcl-2-binding component 3 | Bcl2-L-1 | Bcl2-antagonist of cell death (BAD) |
|---|
| Type: | Mitochondrion membrane; Single-pass membrane protein |
|---|
| Mol. Mass.: | 26039.60 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 233 |
|---|
| Sequence: | MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
|
|
|
|---|
| BDBM185615 |
|---|
| n/a |
|---|
| Name | BDBM185615 |
|---|
| Synonyms: | US9156856, 26 | US9493431, 26 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H28ClN5O4S2 |
|---|
| Mol. Mass. | 646.179 |
|---|
| SMILES | Clc1ccc(cc1)-c1ccccc1CN1CCN(CC1)c1ccc(cc1)C(=O)NS(=O)(=O)c1ccc(\C=C\c2ncon2)s1 |
|---|
| Structure | 
|
|---|
Search and Browse
