| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Thyrotropin subunit beta |
|---|
| Ligand | BDBM189327 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Antagonist Activity Assay |
|---|
| IC50 | 368±0.0 nM |
|---|
| Citation |  Karstens, WF; Conti, PG; Timmers, CM; Plate, R; Van Koppen, CJ TSH receptor antagonizing tetrahydroquinoline compounds US Patent US9174940 Publication Date 11/3/2015 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Thyrotropin subunit beta |
|---|
| Name: | Thyrotropin subunit beta |
|---|
| Synonyms: | TSHB | TSHB_BOVIN | Thyroid-stimulating hormone subunit beta (bTSH) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 15628.77 |
|---|
| Organism: | Bos taurus (Bovine) |
|---|
| Description: | P01223 |
|---|
| Residue: | 138 |
|---|
| Sequence: | MTATFLMSMIFGLACGQAMSFCIPTEYMMHVERKECAYCLTINTTVCAGYCMTRDVNGKL
FLPKYALSQDVCTYRDFMYKTAEIPGCPRHVTPYFSYPVAISCKCGKCNTDYSDCIHEAI
KTNYCTKPQKSYMVGFSI
|
|
|
|---|
| BDBM189327 |
|---|
| n/a |
|---|
| Name | BDBM189327 |
|---|
| Synonyms: | Hexanoic acid (Compound A) | US9174940, Compound A |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H24N2O2 |
|---|
| Mol. Mass. | 336.4275 |
|---|
| SMILES | CC(=O)N1c2ccc(cc2C(C)(CC1(C)C)c1ccccc1)C(N)=O |
|---|
| Structure | 
|
|---|
Search and Browse
