| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase 1 |
|---|
| Ligand | BDBM193737 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | In vitro Carbonic Anhydrase Inhibition Assay |
|---|
| Ki | 767± 132 nM |
|---|
| Citation |  Mert, S; Alim, Z; Isgör, MM; Beydemir, Å¿; Kasimogullari, R The synthesis of novel pyrazole-3,4-dicarboxamides bearing 5-amino-1,3,4-thiadiazole-2-sulfonamide moiety with effective inhibitory activity against the isoforms of human cytosolic carbonic anhydrase I and II. Bioorg Chem68:64-71 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Carbonic anhydrase 1 |
|---|
| Name: | Carbonic anhydrase 1 |
|---|
| Synonyms: | CA-I | CA1 | CAB | CAH1_HUMAN | Carbonate dehydratase I | Carbonic anhydrase | Carbonic anhydrase 1 (CA I) | Carbonic anhydrase 1 (CA-I) | Carbonic anhydrase 1 (Recombinant CA I) | Carbonic anhydrase 2 (CA II) | Carbonic anhydrase B | Carbonic anhydrase I | Carbonic anhydrase I (CA I) | Carbonic anhydrase I (CA-I) | Carbonic anhydrase I (CAI) | Carbonic anhydrase I (hCA I) | Carbonic anhydrase isoenzyme I (hCA I) | hCA |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28873.37 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P00915 |
|---|
| Residue: | 261 |
|---|
| Sequence: | MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH
VAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNF
DPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAV
PMQHNNRPTQPLKGRTVRASF
|
|
|
|---|
| BDBM193737 |
|---|
| n/a |
|---|
| Name | BDBM193737 |
|---|
| Synonyms: | 1-(3-(2-(2,4-Dioxopentan-3-ylidene)hydrazinyl)phenyl)-5-phenyl-N3,N4-bis(5-sulfamoyl-1,3,4-thiadiazol-2-yl)-1H-pyrazole-3,4-dicarboxamide (5) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H22N12O8S4 |
|---|
| Mol. Mass. | 758.788 |
|---|
| SMILES | [#6]-[#6](=O)-[#6](=[#7]/[#7]-c1cccc(c1)-n1nc(-[#6](=O)-[#7]-c2nnc(s2)S([#7])(=O)=O)c(-[#6](=O)-[#7]-c2nnc(s2)S([#7])(=O)=O)c1-c1ccccc1)\[#6](-[#6])=O |
|---|
| Structure | 
|
|---|
Search and Browse
