Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMetalloproteinase with thrombospondin motifs 4 (ADAMTS-4)
LigandBDBM194644
Substrate/Competitorn/a
Meas. Tech.AlphaScreen Assay
pH7.5±n/a
Temperature298.15±n/a K
IC50 2±n/a nM
Commentsextracted
Citation Durham TBMarimuthu JWiley MR Aggrecanase inhibitors US Patent  US9206139 Publication Date 12/8/2015
More Info.:Get all data from this article,  Assay Method
 
Metalloproteinase with thrombospondin motifs 4 (ADAMTS-4)
Name:Metalloproteinase with thrombospondin motifs 4 (ADAMTS-4)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:106624.01
Organism:Canis lupus familiaris (Dog)
Description:E2RFF5
Residue:992
Sequence:
MLKSAGARREAGKDSRGDPQTHRHGRERRRETETKAQRTKPETGQAQRKARQCEGHREAR
GAAGGTGRGRQRPGRGGGARGVWRSQATGRLSAAEGPGSLHLRRRSPAPLQTLPLTLAQV
RAPRLRRGVFQSRGGENLVRSRPPSLPGRGASAMAPTDRRPRRGLAGCWLWGAGPRLPLP
ALPTARPAARLLLPLLLSALLPSGRPAGPLPREEEIVFPERLNGSVPPGLGAPARLLCRL
PAFGETLLLELEQDPGVRVEGLTVQYLGRAPELLGGAEPGTYLTGSINGDPESVASLHWD
GGALLGVLQYRGTELHIQPLEGGSLNSAGGPGAHILRRKSPASGQGPMCNVKAPPGNPSP
SPRRAKRFASLSRFVETLVVADDKMAAFHGAGLKRYLLTVMAAAAKAFKHPSIRNPVSLV
VTRLVILGPGEEGPQVGPSAAQTLRSFCAWQRGLNTPEDSDPDHFDTAILFTRQDLCGVS
TCDTLGMADVGTVCDPARSCAVVEDDGLQSAFTAAHELGHVFNMLHDNSKSCADLNGPGS
TSRHVMAPVMAHVDPEEPWSPCSAHFITEFLDNGYGHCLLDKPEAPLHLPVTFPGKDYDA
DRQCQLTFGPDSRHCPQLPPPCAALWCSGHLNGHAMCQTKHSPWADGTPCGPAQACMGGR
CLHVDQLQDFNIPQAGGWGPWGPWGDCSRSCGGGVQFSSRDCTRPVPRNGGKYCEGRRTR
FRSCNTQDCPTGSALTFREEQCAAYNHRTDLFKSFPGPMDWVPRYTGVAPRDQCKLTCQA
RALGYYYVLEPRVVDGTPCSPDSSSVCVQGRCIHAGCDRVIGSKKKFDKCMVCGGDGSSC
SKQSGSFRKFRYGYNNVVTIPAGATHILVRQQGTPGLRSLYLALKLPDGSYALNGEYTLM
PSPTDVVLPGAVSLRYSGATAASETLSGHGPLAQPLTLQVLVAGNPQNARLRYSFFVPRP
APATARPTPQDWLQRKAQILEILRRRPWAGRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM194644
n/a
NameBDBM194644
Synonyms:US9206139, 3
TypeSmall organic molecule
Emp. Form.C20H22F3N3O3
Mol. Mass.409.4022
SMILESFC(F)(F)c1ccc(C[C@@H](C2CC2)C(=O)NC[C@]2(NC(=O)NC2=O)C2CC2)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: