Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMetalloproteinase with thrombospondin motifs 5 (ADAMTS-5)
LigandBDBM194638
Substrate/Competitorn/a
Meas. Tech.Shift AlphaScreen Assay
IC50 15±n/a nM
Citation Durham TBMarimuthu JWiley MR Aggrecanase inhibitors US Patent  US9206139 Publication Date 12/8/2015
More Info.:Get all data from this article,  Assay Method
 
Metalloproteinase with thrombospondin motifs 5 (ADAMTS-5)
Name:Metalloproteinase with thrombospondin motifs 5 (ADAMTS-5)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:101805.04
Organism:Rattus norvegicus (Rat)
Description:G3V673
Residue:927
Sequence:
MRLEWASLLLLLLLLCASCLALAADNPAAAPAQDKTRQPRAAAAAAQPDQRQWEETQERG
HPQPLARQRRSSGLVQNIDQLYSGGGKVGYLVYAGGRRFLLDLERDDTVGAAGGIVTAGG
LSASSGHRGHCFYRGTVDGSPRSLAVFDLCGGLDGFFAVKHARYTLKPLLRGSWAESERV
YGDGSSRILHVYTREGFSFEALPPRTSCETPASPSGAQESPSVHSSSRRRTELAPQLLDH
SAFSPAGNAGPQTWWRRRRRSISRARQVELLLVADSSMAKMYGRGLQHYLLTLASIANRL
YSHASIENHIRLAVVKVVVLTDKSLEVSKNAATTLKNFCKWQHQHNQLGDDHEEHYDAAI
LFTREDLCGHHSCDTLGMADVGTICSPERSCAVIEDDGLHAAFTVAHEIGHLLGLSHDDS
KFCEENFGSTEDKRLMSSILTSIDASKPWSKCTSATITEFLDDGHGNCLLDVPRKQILGP
EELPGQTYDATQQCNLTFGPEYSVCPGMDVCARLWCAVVRQGQMVCLTKKLPAVEGTPCG
KGRICLQGKCVDKTKKKYYSTSSHGNWGSWGPWGQCSRSCGGGVQFAYRHCNNPAPRNSG
RYCTGKRAIYRSCSVIPCPPNGKSFRHEQCEAKNGYQSDAKGVKTFVEWVPKYAGVLPAD
VCKLTCRAKGTGYYVVFSPKVTDGTECRPYSNSVCVRGRCVRTGCDGIIGSKLQYDKCGV
CGGDNSSCTKIIGTFNKKSKGYTDVVRIPEGATHIKVRQFKAKDQTRFTAYLALKKKTGE
YLINGKYMISTSETIIDINGTVMNYSGWSHRDDFLHGMGYSATKEILIVQILATDPTKAL
DVRYSFFVPKKTTQKVNSVISHSSNKVGLHSPQLQWVTGPWLACSRTCDTGWHTRTVQCQ
DGNRKLAKGCILSQRPSAFKQCLLKKC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM194638
n/a
NameBDBM194638
Synonyms:US9206139, 1
TypeSmall organic molecule
Emp. Form.C18H20F3N3O3
Mol. Mass.383.3649
SMILESC[C@H](Cc1ccc(cc1)C(F)(F)F)C(=O)NC[C@]1(NC(=O)NC1=O)C1CC1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: