| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fatty acid-binding protein, liver |
|---|
| Ligand | BDBM50072775 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | FABP1 Fluorescent Ligand Displacement Assay |
|---|
| Ki | 9.9e+2± 7e+1 nM |
|---|
| Citation |  Huang, H; McIntosh, AL; Martin, GG; Landrock, D; Chung, S; Landrock, KK; Dangott, LJ; Li, S; Kier, AB; Schroeder, F FABP1: A Novel Hepatic Endocannabinoid and Cannabinoid Binding Protein. Biochemistry55:5243-55 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Fatty acid-binding protein, liver |
|---|
| Name: | Fatty acid-binding protein, liver |
|---|
| Synonyms: | FABPL_MOUSE | Fabp1 | Fabpl | Liver fatty acid binding protein (FABP1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 14247.91 |
|---|
| Organism: | Mus musculus (Mouse) |
|---|
| Description: | n/a |
|---|
| Residue: | 127 |
|---|
| Sequence: | MNFSGKYQLQSQENFEPFMKAIGLPEDLIQKGKDIKGVSEIVHEGKKIKLTITYGPKVVR
NEFTLGEECELETMTGEKVKAVVKLEGDNKMVTTFKGIKSVTELNGDTITNTMTLGDIVY
KRVSKRI
|
|
|
|---|
| BDBM50072775 |
|---|
| n/a |
|---|
| Name | BDBM50072775 |
|---|
| Synonyms: | 2-((1R,2R,5R)-5-hydroxy-2-(3-hydroxypropyl)cyclohexyl)-5-(2-methyloctan-2-yl)phenol | 5-(1,1-Dimethyl-heptyl)-2-[(1R,2R,5R)-5-hydroxy-2-(3-hydroxy-propyl)-cyclohexyl]-phenol | 5-(1,1-Dimethyl-heptyl)-2-[(4R,6R)-5-hydroxy-2-((R)-3-hydroxy-propyl)-cyclohexyl]-phenol | CHEMBL48552 | CP-55940 | CP-55940 [(-)-AC],XIV | CP55,940 | CP55940 | ChEMBL_75020 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H40O3 |
|---|
| Mol. Mass. | 376.5726 |
|---|
| SMILES | CCCCCCC(C)(C)c1ccc([C@@H]2C[C@H](O)CC[C@H]2CCCO)c(O)c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
