| Reaction Details |
|---|
 | Report a problem with these data |
| Target | DNA-(apurinic or apyrimidinic site) endonuclease |
|---|
| Ligand | BDBM203863 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Fluorescence-Based APE1 Endonuclease Activity Assay |
|---|
| pH | 7.5±n/a |
|---|
| IC50 | 8.85e+3± 4.8e+2 nM |
|---|
| Comments | extracted |
|---|
| Citation |  Guerreiro, PS; Estácio, SG; Antunes, F; Fernandes, AS; Pinheiro, PF; Costa, JG; Castro, M; Miranda, JP; Guedes, RC; Oliveira, NG Structure-based virtual screening toward the discovery of novel inhibitors of the DNA repair activity of the human apurinic/apyrimidinic endonuclease 1. Chem Biol Drug Des88:915-925 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| DNA-(apurinic or apyrimidinic site) endonuclease |
|---|
| Name: | DNA-(apurinic or apyrimidinic site) endonuclease |
|---|
| Synonyms: | APE | APE1 | APEX | APEX1 | APEX1_HUMAN | APX | Apurinic-apyrimidinic endonuclease 1 (APE-1) | Apurinic/apyrimidinic endonuclease 1 (APE1) | DNA-(apurinic or apyrimidinic site) lyase | HAP1 | REF1 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 35560.12 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P27695 |
|---|
| Residue: | 318 |
|---|
| Sequence: | MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPA
TLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWS
APSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLV
RLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGF
GELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKI
RSKALGSDHCPITLYLAL
|
|
|
|---|
| BDBM203863 |
|---|
| n/a |
|---|
| Name | BDBM203863 |
|---|
| Synonyms: | 6-amino-5-[(4-amino-2-sulfophenyl)azo]-4-hydroxy-2-naphtalenesulfonic acid disodium salt (Compound 41) | NSC 401610 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H12N4O7S2 |
|---|
| Mol. Mass. | 436.42 |
|---|
| SMILES | Nc1ccc(\N=N\c2c(N)ccc3cc(cc(O)c23)S([O-])(=O)=O)c(c1)S([O-])(=O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
