Reaction Details |
| Report a problem with these data |
Target | Baculoviral IAP repeat-containing protein 3 [256-363] |
---|
Ligand | BDBM205383 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | DELFIA Assay |
---|
Temperature | 298.15±n/a K |
---|
IC50 | 28±n/a nM |
---|
Comments | extracted |
---|
Citation | Reiser, U Bis-amido pyridines US Patent US9249151 Publication Date 2/2/2016 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Baculoviral IAP repeat-containing protein 3 [256-363] |
---|
Name: | Baculoviral IAP repeat-containing protein 3 [256-363] |
Synonyms: | API2 | BIRC3 | BIRC3_HUMAN | Cellular inhibitor of apoptosis protein BIR3 domain (cIAP1 BIR-3) | MIHC | RNF49 |
Type: | Protein |
Mol. Mass.: | 12303.07 |
Organism: | Homo sapiens (Human) |
Description: | BIR3 domain of human cIAP1 (256-363 aa) |
Residue: | 108 |
Sequence: | AARFKTFFNWPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLRCWESGDDPWVQHAKW
FPRCEYLIRIKGQEFIRQVQASYPHLLEQLLSTSDSPGDENAESSIIH
|
|
|
BDBM205383 |
---|
n/a |
---|
Name | BDBM205383 |
Synonyms: | US9249151, 29 |
Type | Small organic molecule |
Emp. Form. | C26H26N6O2 |
Mol. Mass. | 454.5236 |
SMILES | CNC(C)C(=O)Nc1cc(cc(NC(=O)c2ccc(C)cn2)n1)-c1c(C)ccc2ncccc12 |
Structure |
|