| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Baculoviral IAP repeat-containing protein 3 [256-363] |
|---|
| Ligand | BDBM205386 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | DELFIA Assay |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | 53±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Reiser, U Bis-amido pyridines US Patent US9249151 Publication Date 2/2/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Baculoviral IAP repeat-containing protein 3 [256-363] |
|---|
| Name: | Baculoviral IAP repeat-containing protein 3 [256-363] |
|---|
| Synonyms: | API2 | BIRC3 | BIRC3_HUMAN | Cellular inhibitor of apoptosis protein BIR3 domain (cIAP1 BIR-3) | MIHC | RNF49 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 12303.07 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | BIR3 domain of human cIAP1 (256-363 aa) |
|---|
| Residue: | 108 |
|---|
| Sequence: | AARFKTFFNWPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLRCWESGDDPWVQHAKW
FPRCEYLIRIKGQEFIRQVQASYPHLLEQLLSTSDSPGDENAESSIIH
|
|
|
|---|
| BDBM205386 |
|---|
| n/a |
|---|
| Name | BDBM205386 |
|---|
| Synonyms: | US9249151, 32 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H23FN6O2 |
|---|
| Mol. Mass. | 458.4875 |
|---|
| SMILES | CNC(C)C(=O)Nc1cc(cc(NC(=O)c2ccc(F)cn2)n1)-c1c(C)ccc2ncccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
