Reaction Details |
| Report a problem with these data |
Target | Bromodomain testis-specific protein [251-382] |
---|
Ligand | BDBM205429 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Bromodomains Assay for DiscoveRx Gene Symbol |
---|
Kd | 35±0.0 nM |
---|
Citation | Tanaka, M; Roberts, JM; Seo, HS; Souza, A; Paulk, J; Scott, TG; DeAngelo, SL; Dhe-Paganon, S; Bradner, JE Design and characterization of bivalent BET inhibitors. Nat Chem Biol12:1089-1096 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Bromodomain testis-specific protein [251-382] |
---|
Name: | Bromodomain testis-specific protein [251-382] |
Synonyms: | BRDT | BRDT_HUMAN | Bromodomain testis 2 (BRDT(2)) |
Type: | n/a |
Mol. Mass.: | 15596.28 |
Organism: | Homo sapiens (Human) |
Description: | Q58F21 (BRDT, 251-382) |
Residue: | 132 |
Sequence: | KNVLPDSQQQYNVVKTVKVTEQLRHCSEILKEMLAKKHFSYAWPFYNPVDVNALGLHNYY
DVVKNPMDLGTIKEKMDNQEYKDAYKFAADVRLMFMNCYKYNPPDHEVVTMARMLQDVFE
THFSKIPIEPVE
|
|
|
BDBM205429 |
---|
n/a |
---|
Name | BDBM205429 |
Synonyms: | (R)-JQ1 (3) | US10407441, Compound (R)-JQ1 | US10925881, Name (R)-JQ1 | US11028051, Cmpd (+)-JQ1 | US11117865, Compound JQ1 | US11306105, Compound JQ1 | US11406645, Compound JQ1 | US11542273, Example (+)-JQ1 | US11890288, Compound (+)-JQ1 | US9320741, (R)-JQ1 |
Type | Small organic molecule |
Emp. Form. | C23H25ClN4O2S |
Mol. Mass. | 456.988 |
SMILES | Cc1nnc2[C@@H](CC(=O)OC(C)(C)C)N=C(c3c(C)c(C)sc3-n12)c1ccc(Cl)cc1 |r,c:14| |
Structure |
|