| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Catechol O-methyltransferase |
|---|
| Ligand | BDBM206347 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Fluorescence Polarization Assay |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | 93±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Wolkenberg, S; Harrison, ST; Barrow, JC; Zhao, Z; Melamed, J; Kett, NR; Zartman, A Inhibitors of catechol O-methyl transferase and their use in the treatment of psychotic disorders US Patent US9260413 Publication Date 2/16/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Catechol O-methyltransferase |
|---|
| Name: | Catechol O-methyltransferase |
|---|
| Synonyms: | COMT | COMT_HUMAN | Catechol O-methyltransferase | Catechol O-methyltransferase (MB-COMT) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 30030.67 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P21964 |
|---|
| Residue: | 271 |
|---|
| Sequence: | MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRIL
NHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCG
YSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKY
DVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFE
CTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
|
|
|
|---|
| BDBM206347 |
|---|
| n/a |
|---|
| Name | BDBM206347 |
|---|
| Synonyms: | US9260413, Example 5 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H16N2O4 |
|---|
| Mol. Mass. | 324.3306 |
|---|
| SMILES | COc1ccc(Oc2cccc(c2)-c2ncc(O)c(=O)n2C)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
