| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Alpha-synuclein |
|---|
| Ligand | BDBM207934 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | In Vitro Inhibition Assay |
|---|
| EC50 | 581±n/a nM |
|---|
| Citation |  Griffioen, G; Van Dooren, T; Rojas De La Parra, V; Allasia, S; Marchand, A; Kilonda, A; Chaltin, P Compounds for the treatment of neurodegenerative diseases US Patent US9266832 Publication Date 2/23/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Alpha-synuclein |
|---|
| Name: | Alpha-synuclein |
|---|
| Synonyms: | NACP | PARK1 | SNCA | SYUA_HUMAN |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 14451.42 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P37840 |
|---|
| Residue: | 140 |
|---|
| Sequence: | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP
DNEAYEMPSEEGYQDYEPEA
|
|
|
|---|
| BDBM207934 |
|---|
| n/a |
|---|
| Name | BDBM207934 |
|---|
| Synonyms: | US9266832, Cpd091 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H22ClFN2O |
|---|
| Mol. Mass. | 420.906 |
|---|
| SMILES | Cn1cc(CCNC(=O)c2ccc(Cc3cccc(F)c3)cc2)c2cc(Cl)ccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
