| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ileal sodium/bile acid cotransporter |
|---|
| Ligand | BDBM77033 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Pharmaceutical Effect Mean Inhibitory Effect |
|---|
| IC50 | 0.350±n/a nM |
|---|
| Citation |  Gillberg, P; Graffner, H; Starke, I IBAT inhibitors for the treatment of liver diseases US Patent US10093697 Publication Date 10/9/2018 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Ileal sodium/bile acid cotransporter |
|---|
| Name: | Ileal sodium/bile acid cotransporter |
|---|
| Synonyms: | ASBT | Apical sodium-dependent bile acid transporter | IBAT | ISBT | Ileal Na(+)/bile acid cotransporter | Ileal bile acid transporter | Ileal bile acid transporter/bile acid cotransporter | Ileal sodium-dependent bile acid transporter | NTCP2 | NTCP2_HUMAN | SLC10A2 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 37714.89 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | SLC10A2 |
|---|
| Residue: | 348 |
|---|
| Sequence: | MNDPNSCVDNATVCSGASCVVPESNFNNILSVVLSTVLTILLALVMFSMGCNVEIKKFLG
HIKRPWGICVGFLCQFGIMPLTGFILSVAFDILPLQAVVVLIIGCCPGGTASNILAYWVD
GDMDLSVSMTTCSTLLALGMMPLCLLIYTKMWVDSGSIVIPYDNIGTSLVSLVVPVSIGM
FVNHKWPQKAKIILKIGSIAGAILIVLIAVVGGILYQSAWIIAPKLWIIGTIFPVAGYSL
GFLLARIAGLPWYRCRTVAFETGMQNTQLCSTIVQLSFTPEELNVVFTFPLIYSIFQLAF
AAIFLGFYVAYKKCHGKNKAEIPESKENGTEPESSFYKANGGFQPDEK
|
|
|
|---|
| BDBM77033 |
|---|
| n/a |
|---|
| Name | BDBM77033 |
|---|
| Synonyms: | US10093697, 4. | US10487111, Example 4. | US9694018, 4 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C37H48N4O7S3 |
|---|
| Mol. Mass. | 756.995 |
|---|
| SMILES | CCCCC1(CCCC)CN(c2ccccc2)c2cc(SC)c(OCC(=O)N[C@@H](C(=O)N[C@@H](CSC)C(O)=O)c3ccccc3)cc2S(=O)(=O)N1 |r,$;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;HN;;;;;;;;;;;;;;;;;;;HN$| |
|---|
| Structure | 
|
|---|
Search and Browse
