Reaction Details |
| Report a problem with these data |
Target | Ileal sodium/bile acid cotransporter |
---|
Ligand | BDBM77074 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Pharmaceutical Effect Mean Inhibitory Effect |
---|
IC50 | 0.200±n/a nM |
---|
Citation | Gillberg, P; Graffner, H; Starke, I IBAT inhibitors for the treatment of liver diseases US Patent US10093697 Publication Date 10/9/2018 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Ileal sodium/bile acid cotransporter |
---|
Name: | Ileal sodium/bile acid cotransporter |
Synonyms: | ASBT | Apical sodium-dependent bile acid transporter | IBAT | ISBT | Ileal Na(+)/bile acid cotransporter | Ileal bile acid transporter | Ileal bile acid transporter/bile acid cotransporter | Ileal sodium-dependent bile acid transporter | NTCP2 | NTCP2_HUMAN | SLC10A2 |
Type: | Enzyme |
Mol. Mass.: | 37714.89 |
Organism: | Homo sapiens (Human) |
Description: | SLC10A2 |
Residue: | 348 |
Sequence: | MNDPNSCVDNATVCSGASCVVPESNFNNILSVVLSTVLTILLALVMFSMGCNVEIKKFLG
HIKRPWGICVGFLCQFGIMPLTGFILSVAFDILPLQAVVVLIIGCCPGGTASNILAYWVD
GDMDLSVSMTTCSTLLALGMMPLCLLIYTKMWVDSGSIVIPYDNIGTSLVSLVVPVSIGM
FVNHKWPQKAKIILKIGSIAGAILIVLIAVVGGILYQSAWIIAPKLWIIGTIFPVAGYSL
GFLLARIAGLPWYRCRTVAFETGMQNTQLCSTIVQLSFTPEELNVVFTFPLIYSIFQLAF
AAIFLGFYVAYKKCHGKNKAEIPESKENGTEPESSFYKANGGFQPDEK
|
|
|
BDBM77074 |
---|
n/a |
---|
Name | BDBM77074 |
Synonyms: | US10093697, 10. | US10487111, Example 10. | US9694018, 10 |
Type | Small organic molecule |
Emp. Form. | C36H46N4O7S2 |
Mol. Mass. | 710.903 |
SMILES | CCCCC1(CCCC)CN(c2ccccc2)c2cc(SC)c(OCC(=O)N[C@@H](C(=O)N[C@@H](C)C(O)=O)c3ccccc3)cc2S(=O)(=O)N1 |r,$;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;HN;;;;;;;;;;;;;;;;;HN$| |
Structure |
|