Reaction Details |
| Report a problem with these data |
Target | Bcl-2-like protein 1 |
---|
Ligand | BDBM209202 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Time Resolved-Fluorescence Resonance Energy Transfer (TR-FRET) Assay |
---|
Temperature | 298.15±n/a K |
---|
Ki | <0.1±n/a nM |
---|
Comments | extracted |
---|
Citation | Wang, L; Doherty, G; Wang, X; Tao, Z; Bruncko, M; Kunzer, AR; Wendt, MD; Song, X; Frey, R; Hansen, TM; Sullivan, GM; Judd, A; Souers, A Apoptosis-inducing agents for the treatment of cancer and immune and autoimmune diseases US Patent US9266877 Publication Date 2/23/2016 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Bcl-2-like protein 1 |
---|
Name: | Bcl-2-like protein 1 |
Synonyms: | Anti-apoptotic Bcl-2 protein | Apoptosis Regulator Bcl-xL | Apoptosis regulator Bcl-X | B2CL1_HUMAN | BCL2-like 1 isoform 1 | BCL2L | BCL2L1 | BCLX | Bcl-2-like protein 1 (Bcl-XL) | Bcl-X | Bcl-xL/Bcl-2-binding component 3 | Bcl2-L-1 | Bcl2-antagonist of cell death (BAD) |
Type: | Mitochondrion membrane; Single-pass membrane protein |
Mol. Mass.: | 26039.60 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 233 |
Sequence: | MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
|
|
|
BDBM209202 |
---|
n/a |
---|
Name | BDBM209202 |
Synonyms: | US9266877, 148 |
Type | Small organic molecule |
Emp. Form. | C39H45N7O5S2 |
Mol. Mass. | 755.949 |
SMILES | COCCC1(Cn2ncc(c2C)-c2ccc(nc2C(=O)NS(C)(=O)=O)N2CCc3cccc(C(=O)Nc4nc5ccccc5s4)c3C2)CCCCCC1 |
Structure |
|