| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 2''-aminoglycoside nucleotidyltransferase |
|---|
| Ligand | BDBM50189123 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | In Vitro ANT(2")-Ia Pyrophosphatase Assay |
|---|
| Ki | 1.29e+4± 4.8e+3 nM |
|---|
| Citation |  Cox, G; Sieron, A; King, AM; De Pascale, G; Pawlowski, AC; Koteva, K; Wright, GD A Common Platform for Antibiotic Dereplication and Adjuvant Discovery. Cell Chem Biol24:98-109 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 2''-aminoglycoside nucleotidyltransferase |
|---|
| Name: | 2''-aminoglycoside nucleotidyltransferase |
|---|
| Synonyms: | AADB1_KLEPN | Aminoglycoside 2-O nucleotidyltransferase (ANT(2")-Ia) | aadB |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 19858.57 |
|---|
| Organism: | Klebsiella pneumoniae |
|---|
| Description: | P0AE05 |
|---|
| Residue: | 177 |
|---|
| Sequence: | MDTTQVTLIHKILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAI
VEMLGGRVMEELDYGFLAEIGDELLDCEPAWWADEAYEIAEAPQGSCPEAAEGVIAGRPV
RCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLGAEKVEVLRAAFRSRYAA
|
|
|
|---|
| BDBM50189123 |
|---|
| n/a |
|---|
| Name | BDBM50189123 |
|---|
| Synonyms: | (4-benzyloxy-3-chloro-phenyl)-{6-[5-(1-oxo-1lambda*4*-thiomorpholin-4-ylmethyl)-furan-2-yl]-quinazolin-4-yl}-amine | CHEMBL212965 | GW583373A |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H27ClN4O3S |
|---|
| Mol. Mass. | 559.078 |
|---|
| SMILES | Clc1cc(Nc2ncnc3ccc(cc23)-c2ccc(CN3CCS(=O)CC3)o2)ccc1OCc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
