| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Taste receptor type 2 member 8 |
|---|
| Ligand | BDBM211361 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Fluorescence Polarization Assays |
|---|
| IC50 | 20.00±n/a nM |
|---|
| Citation |  Karanewsky, DS; Fotsing, JR; Tachdjian, C; Arellano, M Identification of human T2R receptors that respond to bitter compounds that elicit the bitter taste in compositions, and the use thereof in assays to identify compounds that inhibit (block) bitter taste in compositions and use thereof US Patent US9247759 Publication Date 2/2/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Taste receptor type 2 member 8 |
|---|
| Name: | Taste receptor type 2 member 8 |
|---|
| Synonyms: | T2R8 | TA2R8_HUMAN | TAS2R8 | TRB5 | Taste receptor family B member 5 | Taste receptor type 2 member 8 (T2R8) |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 35897.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9NYW2 |
|---|
| Residue: | 309 |
|---|
| Sequence: | MFSPADNIFIILITGEFILGILGNGYIALVNWIDWIKKKKISTVDYILTNLVIARICLIS
VMVVNGIVIVLNPDVYTKNKQQIVIFTFWTFANYLNMWITTCLNVFYFLKIASSSHPLFL
WLKWKIDMVVHWILLGCFAISLLVSLIAAIVLSCDYRFHAIAKHKRNITEMFHVSKIPYF
EPLTLFNLFAIVPFIVSLISFFLLVRSLWRHTKQIKLYATGSRDPSTEVHVRAIKTMTSF
IFFFFLYYISSILMTFSYLMTKYKLAVEFGEIAAILYPLGHSLILIVLNNKLRQTFVRML
TCRKIACMI
|
|
|
|---|
| BDBM211361 |
|---|
| n/a |
|---|
| Name | BDBM211361 |
|---|
| Synonyms: | US9247759, 12-12 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H23N5O5 |
|---|
| Mol. Mass. | 437.4485 |
|---|
| SMILES | COc1ccc(CN2C(=O)N(C(=O)C22CC2)c2cnn(Cc3c(C)noc3C)c2)cc1O |
|---|
| Structure | 
|
|---|
Search and Browse
