| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fatty acid-binding protein 5 |
|---|
| Ligand | BDBM212446 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Time Resolved-Fluorescence Energy Transfer (TR-FRET) Assay |
|---|
| pH | 7.5±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | >50000±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Buettelmann, B; Ceccarelli, SM; Conte, A; Kuehne, H; Kuhn, B; Neidhart, W; Obst Sander, U; Richter, H Urea derivatives and their use as fatty-acid binding protein (FABP) inhibitors US Patent US9278918 Publication Date 3/8/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Fatty acid-binding protein 5 |
|---|
| Name: | Fatty acid-binding protein 5 |
|---|
| Synonyms: | FABP5 | FABP5_HUMAN | Fatty acid binding protein epidermal | Fatty acid-binding protein 5 (FABP5) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 15164.79 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q01469 |
|---|
| Residue: | 135 |
|---|
| Sequence: | MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTL
KTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVEC
VMNNVTCTRIYEKVE
|
|
|
|---|
| BDBM212446 |
|---|
| n/a |
|---|
| Name | BDBM212446 |
|---|
| Synonyms: | US9278918, 32 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H18N2O3 |
|---|
| Mol. Mass. | 310.3471 |
|---|
| SMILES | CN(C(=O)Nc1ccccc1-c1ccccc1)C1(CC1)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
