Reaction Details |
| Report a problem with these data |
Target | E3 ubiquitin-protein ligase XIAP [241-356] |
---|
Ligand | BDBM213373 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | XIAP BIR3 & cIAP1 BIR3 Binding Assays (DELFIA) |
---|
Temperature | 298.15±n/a K |
---|
IC50 | 222±n/a nM |
---|
Comments | extracted |
---|
Citation | Reiser, U; Madden, J 6-Alkynyl Pyridine US Patent US9278978 Publication Date 3/8/2016 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
E3 ubiquitin-protein ligase XIAP [241-356] |
---|
Name: | E3 ubiquitin-protein ligase XIAP [241-356] |
Synonyms: | API3 | BIR3 domain of X-linked inhibitor of apoptosis protein | BIRC4 | E3 ubiquitin-protein ligase (XIAP-BIR3) | E3 ubiquitin-protein ligase XIAP BIR-3 | E3 ubiquitin-protein ligase XIAP BIR3 | IAP3 | X chromosome-linked inhibitor of apoptosis BIR3 domain (XIAP BIR3) | X-linked inhibitor of apoptosis protein BIR3 domain (XIAP BIR-3) | XIAP | XIAP-BIR3 | XIAP_HUMAN | baculovirus IAP repeat 3 (BIR3) domain of XIAP |
Type: | Protein Binding Domain |
Mol. Mass.: | 13276.62 |
Organism: | Homo sapiens (Human) |
Description: | BIR3 of XIAP: RESIDUES 241-356. |
Residue: | 116 |
Sequence: | SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKC
FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTT
|
|
|
BDBM213373 |
---|
n/a |
---|
Name | BDBM213373 |
Synonyms: | US9278978, 8 |
Type | Small organic molecule |
Emp. Form. | C27H24N8O2 |
Mol. Mass. | 492.5319 |
SMILES | CN[C@H](C)C(=O)Nc1cc(cc(n1)C#Cc1ccc2n(C)c(=O)ccc2c1)-c1ncnc2cnn(C)c12 |r| |
Structure |
|