| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Iodotyrosine deiodinase [1-228] |
|---|
| Ligand | BDBM217400 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | IYD Binding Assay |
|---|
| Kd | 1.44e+3± 5e+1 nM |
|---|
| Citation |  Ingavat, N; Kavran, JM; Sun, Z; Rokita, SE Active Site Binding Is Not Sufficient for Reductive Deiodination by Iodotyrosine Deiodinase. Biochemistry56:1130-1139 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Iodotyrosine deiodinase [1-228] |
|---|
| Name: | Iodotyrosine deiodinase [1-228] |
|---|
| Synonyms: | IYD | IYD_HALH1 | Iodotyrosine deiodinase (IYD) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 26134.19 |
|---|
| Organism: | Haliscomenobacter hydrossis |
|---|
| Description: | F4KU78[1-228] |
|---|
| Residue: | 228 |
|---|
| Sequence: | MKQKPAFIPYAGAQFEPEEMLSKSAEYYQFMDHRRTVREFSNRAIPLEVIENIVMTASTA
PSGAHKQPWTFVVVSDPQIKAKIRQAAEKEEFESYNGRMSNEWLEDLQPFGTDWHKPFLE
IAPYLIVVFRKAYDVLPDGTQRKNYYVQESVGIACGFLLAAIHQAGLVALTHTPSPMNFL
QKILQRPENERPFLLVPVGYPAEGAMVPDLQRKDKAAVMVVYHHHHHH
|
|
|
|---|
| BDBM217400 |
|---|
| n/a |
|---|
| Name | BDBM217400 |
|---|
| Synonyms: | 4-Cyano-2-iodophenol (2IPCN) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C7H4INO |
|---|
| Mol. Mass. | 245.0172 |
|---|
| SMILES | Oc1ccc(cc1I)C#N |
|---|
| Structure | 
|
|---|
Search and Browse
