| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Apoptosis regulator Bcl-2 |
|---|
| Ligand | BDBM60828 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | DELFIA |
|---|
| IC50 | 4.4±0.1 nM |
|---|
| Citation |  Barile, E; Marconi, GD; De, SK; Baggio, C; Gambini, L; Salem, AF; Kashyap, MK; Castro, JE; Kipps, TJ; Pellecchia, M hBfl-1/hNOXA Interaction Studies Provide New Insights on the Role of Bfl-1 in Cancer Cell Resistance and for the Design of Novel Anticancer Agents. ACS Chem Biol12:444-455 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Apoptosis regulator Bcl-2 |
|---|
| Name: | Apoptosis regulator Bcl-2 |
|---|
| Synonyms: | Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | BCL2 | BCL2_HUMAN | Bcl-2 Protein |
|---|
| Type: | Homodimer or heterodimer |
|---|
| Mol. Mass.: | 26269.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P10415 |
|---|
| Residue: | 239 |
|---|
| Sequence: | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
|
|
|
|---|
| BDBM60828 |
|---|
| n/a |
|---|
| Name | BDBM60828 |
|---|
| Synonyms: | ABT-199 | BDBM189459 | US10213433, Compound 5 | US10377755, Example ABT-199 | US11318134, Example ABT-199 | US11369599, Compound 369 | US11590126, Example ABT-199 | US11718611, Example T-7 | US20240043404, Example 369 | US9174982, 369 |
|---|
| Type | n/a |
|---|
| Emp. Form. | C45H50ClN7O7S |
|---|
| Mol. Mass. | 868.439 |
|---|
| SMILES | CC1(C)CCC(CN2CCN(CC2)c2ccc(C(=O)NS(=O)(=O)c3ccc(NCC4CCOCC4)c(c3)[N+]([O-])=O)c(Oc3cnc4[nH]ccc4c3)c2)=C(C1)c1ccc(Cl)cc1 |c:57| |
|---|
| Structure | 
|
|---|
Search and Browse
