| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Paired box protein Pax-2 [1-81] |
|---|
| Ligand | BDBM218809 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Biolayer Interferometry Binding Assay |
|---|
| Kd | 1.35e+3±n/a nM |
|---|
| Citation |  Grimley, E; Liao, C; Ranghini, EJ; Nikolovska-Coleska, Z; Dressler, GR Inhibition of Pax2 Transcription Activation with a Small Molecule that Targets the DNA Binding Domain. ACS Chem Biol12:724-734 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Paired box protein Pax-2 [1-81] |
|---|
| Name: | Paired box protein Pax-2 [1-81] |
|---|
| Synonyms: | PAX2 | PAX2_HUMAN | Paired box protein 2 (Pax2) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 8841.67 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human Pax2 (1-81 aa) containing the first DNA binding pocket defined in this study's homology model. |
|---|
| Residue: | 81 |
|---|
| Sequence: | MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRV
SHGCVSKILGRYYETGSIKPG
|
|
|
|---|
| BDBM218809 |
|---|
| n/a |
|---|
| Name | BDBM218809 |
|---|
| Synonyms: | EG1 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H18N2O5 |
|---|
| Mol. Mass. | 390.3887 |
|---|
| SMILES | COc1ccccc1C(=O)Nc1ccc(cc1)C(=O)Nc1ccccc1C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
