Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPaired box protein 2 (Pax2)
LigandBDBM218809
Substrate/Competitorn/a
Meas. Tech.Biolayer Interferometry Binding Assay
Kd 1.35e+3± 0 nM
Citation Grimley ELiao CRanghini EJNikolovska-Coleska ZDressler GR Inhibition of Pax2 Transcription Activation with a Small Molecule that Targets the DNA Binding Domain. ACS Chem Biol 12:724-734 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Paired box protein 2 (Pax2)
Name:Paired box protein 2 (Pax2)
Synonyms:n/a
Type:Protein
Mol. Mass.:8841.67
Organism:Homo sapiens (Human)
Description:Human Pax2 (1-81 aa) containing the first DNA binding pocket defined in this study's homology model.
Residue:81
Sequence:
MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRV
SHGCVSKILGRYYETGSIKPG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM218809
n/a
NameBDBM218809
Synonyms:EG1
TypeSmall organic molecule
Emp. Form.C22H18N2O5
Mol. Mass.390.3887
SMILESCOc1ccccc1C(=O)Nc1ccc(cc1)C(=O)Nc1ccccc1C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: