Reaction Details |
| Report a problem with these data |
Target | Paired box protein Pax-2 [1-81] |
---|
Ligand | BDBM218809 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Biolayer Interferometry Binding Assay |
---|
Kd | 1.5e+3±n/a nM |
---|
Citation | Grimley, E; Liao, C; Ranghini, EJ; Nikolovska-Coleska, Z; Dressler, GR Inhibition of Pax2 Transcription Activation with a Small Molecule that Targets the DNA Binding Domain. ACS Chem Biol12:724-734 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Paired box protein Pax-2 [1-81] |
---|
Name: | Paired box protein Pax-2 [1-81] |
Synonyms: | PAX2 | PAX2_HUMAN | Paired box protein 2 (Pax2) |
Type: | Protein |
Mol. Mass.: | 8841.67 |
Organism: | Homo sapiens (Human) |
Description: | Human Pax2 (1-81 aa) containing the first DNA binding pocket defined in this study's homology model. |
Residue: | 81 |
Sequence: | MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRV
SHGCVSKILGRYYETGSIKPG
|
|
|
BDBM218809 |
---|
n/a |
---|
Name | BDBM218809 |
Synonyms: | EG1 |
Type | Small organic molecule |
Emp. Form. | C22H18N2O5 |
Mol. Mass. | 390.3887 |
SMILES | COc1ccccc1C(=O)Nc1ccc(cc1)C(=O)Nc1ccccc1C(O)=O |
Structure |
|