| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Forkhead box protein M1 [235-327] |
|---|
| Ligand | BDBM218818 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Fluorescence-based Affinity Assay |
|---|
| Kd | 3.8e+3±n/a nM |
|---|
| Citation |  Dong, C; Yan, P; Wang, J; Mu, H; Wang, S; Guo, F Rational identification of natural organic compounds to target the intermolecular interaction between Foxm and DNA in colorectal cancer. Bioorg Chem70:12-16 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Forkhead box protein M1 [235-327] |
|---|
| Name: | Forkhead box protein M1 [235-327] |
|---|
| Synonyms: | FKHL16 | FOXM1 | FOXM1_HUMAN | Forkhead box M DNA-binding domain (Foxm DBD) | HFH11 | MPP2 | WIN |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 11168.28 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human Foxm BDB (235-327 aa) |
|---|
| Residue: | 93 |
|---|
| Sequence: | ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDM
FVRETSANGKVSFWTIHPSANRYLTLDQVFKPL
|
|
|
|---|
| BDBM218818 |
|---|
| n/a |
|---|
| Name | BDBM218818 |
|---|
| Synonyms: | CID 2753793 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H9N3OS2 |
|---|
| Mol. Mass. | 287.36 |
|---|
| SMILES | N=c1sc(nn1-c1ccccc1)C(=O)c1cccs1 |
|---|
| Structure | 
|
|---|
Search and Browse
