Reaction Details |
| Report a problem with these data |
Target | Aldo-keto reductase family 1 member C3 |
---|
Ligand | BDBM50067678 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Discontinuous Radiometric Assay |
---|
IC50 | 280±n/a nM |
---|
Citation | Penning, TM; Adeniji, AO; Burns, MC; Winkler, J; Twenter, B Bifunctional AKR1C3 inhibitors/androgen receptor modulators and methods of use thereof US Patent US9271961 Publication Date 3/1/2016 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Aldo-keto reductase family 1 member C3 |
---|
Name: | Aldo-keto reductase family 1 member C3 |
Synonyms: | 17-beta-Hydroxysteroid Dehydrogenase 5 (17-beta-HSD5, AKR1C3) | 3-alpha-HSD type 2 | AK1C3_HUMAN | AKR1C3 | Aldo-keto reductase family 1 member C3 | Aldo-keto reductase family 1 member C3 (AK1C3) | Aldo-keto reductase family 1 member C3 (AK1C3a) | Aldo-keto reductase family 1 member C3 (AKR1C3) | Aldo-keto-reductase family 1 member C3 | DDH1 | Dihydrodiol dehydrogenase 3 | Dihydrodiol dehydrogenase type I | Estradiol 17-beta-dehydrogenase | HSD17B5 | KIAA0119 | PGFS | Prostaglandin F synthase | Testosterone 17-beta-dehydrogenase 5 | Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase |
Type: | Enzyme |
Mol. Mass.: | 36859.86 |
Organism: | Homo sapiens (Human) |
Description: | P42330 |
Residue: | 323 |
Sequence: | MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPM
SLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD
RNLHYFNSDSFASHPNYPYSDEY
|
|
|
BDBM50067678 |
---|
n/a |
---|
Name | BDBM50067678 |
Synonyms: | (6alpha)-17-(Acetyloxy)-6-methylpreg-4-ene-3,20-dione | (6alpha)-6-methyl-3,20-dioxopregn-4-en-17-yl acetate | 17-Acetoxy-6alpha-methylprogesterone | 17alpha-Hydroxy-6alpha-methylprogesterone acetate | 6-alpha-Methyl-17-alpha-acetoxyprogesterone | 6-alpha-Methyl-17-alpha-hydroxyprogesterone acetate | 6alpha-Methyl-17-acetoxy progesterone | 6alpha-Methyl-17alpha-hydroxyprogesterone acetate | 6alpha-Methyl-4-pregnene-3,20-dion-17alpha-ol acetate | MEDROXYPROGESTERONE | Medroxyacetate progesterone | Medroxyprogesterone 17-acetate | Methylacetoxyprogesterone | Metigestrona | US9271961, MPA | medroxyprogesterone acetate |
Type | Small organic molecule |
Emp. Form. | C24H34O4 |
Mol. Mass. | 386.5244 |
SMILES | C[C@H]1C[C@H]2[C@@H]3CC[C@](OC(C)=O)(C(C)=O)[C@@]3(C)CC[C@@H]2[C@@]2(C)CCC(=O)C=C12 |r,t:28| |
Structure |
|