Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetalpha-Glucosidase (alpha-Glu)
LigandBDBM223124
Substrate/Competitorn/a
Meas. Tech.In Vitro α-Glucosidase Inhibitory Assay
pH6.8±n/a
IC50 2850±60 nM
Commentsextracted
Citation Wang GWang JHe DLi XLi JPeng Z Synthesis, in vitro evaluation and molecular docking studies of novel coumarin-isatin derivatives as a-glucosidase inhibitors. Chem Biol Drug Des 89:456-463 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
alpha-Glucosidase (alpha-Glu)
Name:alpha-Glucosidase (alpha-Glu)
Synonyms:Alpha-glucosidase MAL32 | Maltase | alpha-Glucosidase (α-Glucosidase) | alpha-Glucosidase (α-Glucosidase)
Type:Hydrolase
Mol. Mass.:68132.36
Organism:Saccharomyces cerevisiae
Description:Purchased from Wako Fine Chemicals Co. Ltd.
Residue:584
Sequence:
MTISDHPETEPKWWKEATIYQIYPASFKDSNNDGWGDLKGITSKLQYIKDLGVDAIWVCP
FYDSPQQDMGYDISNYEKVWPTYGTNEDCFELIDKTHKLGMKFITDLVINHCSTEHEWFK
ESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSFFGGSAWTFDETTNEFYLRLFASR
QVDLNWENEDCRRAIFESAVGFWLDHGVDGFRIDTAGLYSKRPGLPDSPIFDKTSKLQHP
NWGSHNGPRIHEYHQELHRFMKNRVKDGREIMTVGEVAHGSDNALYTSAARYEVSEVFSF
THVELGTSPFFRYNIVPFTLKQWKEAIASNFLFINGTDSWATTYIENHDQARSITRFADD
SPKYRKISGKLLTLLECSLTGTLYVYQGQEIGQINFKEWPIEKYEDVDVKNNYEIIKKSF
GKNSKEMKDFFKGIALLSRDHSRTPMPWTKDKPNAGFTGPDVKPWFFLNESFEQGINVEQ
ESRDDDSVLNFWKRALQARKKYKELMIYGYDFQFIDLDSDQIFSFTKEYEDKTLFAALNF
SGEEIEFSLPREGASLSFILGNYDDTDVSSRVLKPWEGRIYLVK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM223124
n/a
NameBDBM223124
Synonyms:(Z)-N'-(5-bromo-1-(2-chlorobenzyl)-2-oxoindolin-3-ylidene)-2-((2-oxo-2H-chromen-7-yl)oxy)acetohydrazide (5s)
TypeSmall organic molecule
Emp. Form.C26H17BrClN3O5
Mol. Mass.566.787
SMILESClc1ccccc1CN1C(=O)\C(=N/NC(=O)COc2ccc3ccc(=O)oc3c2)c2cc(Br)ccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: