| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ephrin type-A receptor 4 [29-209] |
|---|
| Ligand | BDBM223311 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Isothermal Titration Calorimetry (ITC) |
|---|
| pH | 6.5±0 |
|---|
| Temperature | 300.15±0 K |
|---|
| Kd | 420±20 nM |
|---|
| Citation |  Wu, B; De, SK; Kulinich, A; Salem, AF; Koeppen, J; Wang, R; Barile, E; Wang, S; Zhang, D; Ethell, I; Pellecchia, M Potent and Selective EphA4 Agonists for the Treatment of ALS. Cell Chem Biol24:293-305 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Ephrin type-A receptor 4 [29-209] |
|---|
| Name: | Ephrin type-A receptor 4 [29-209] |
|---|
| Synonyms: | EPHA4 | EPHA4_HUMAN | Ephrin type-A receptor 4 ligand binding domain (EphA4-LBD) | HEK8 | SEK | TYRO1 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 20850.44 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human EphA4-LBD (29-209 aa) |
|---|
| Residue: | 181 |
|---|
| Sequence: | NEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDW
ITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTI
AADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTV
R
|
|
|
|---|
| BDBM223311 |
|---|
| n/a |
|---|
| Name | BDBM223311 |
|---|
| Synonyms: | 123C4 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C43H47ClN8O6 |
|---|
| Mol. Mass. | 807.336 |
|---|
| SMILES | COc1ccc2[nH]cc(CCNC(=O)[C@H](Cc3ccncc3)NC(=O)[C@H](Cc3ccc(Cl)cc3)NC(=O)[C@H](Cc3c[nH]c4ccc(O)cc34)NC(=O)CCCN)c2c1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
