Reaction Details |
| Report a problem with these data |
Target | Ephrin type-A receptor 4 [29-209,I67A] |
---|
Ligand | BDBM223311 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Isothermal Titration Calorimetry (ITC) |
---|
pH | 6.5±0 |
---|
Temperature | 300.15±0 K |
---|
Kd | 780±80 nM |
---|
Citation | Wu, B; De, SK; Kulinich, A; Salem, AF; Koeppen, J; Wang, R; Barile, E; Wang, S; Zhang, D; Ethell, I; Pellecchia, M Potent and Selective EphA4 Agonists for the Treatment of ALS. Cell Chem Biol24:293-305 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Ephrin type-A receptor 4 [29-209,I67A] |
---|
Name: | Ephrin type-A receptor 4 [29-209,I67A] |
Synonyms: | EPHA4 | EPHA4_HUMAN | Ephrin type-A receptor 4 ligand binding domain (I67A-EphA4-LBD) | HEK8 | SEK | TYRO1 |
Type: | Protein |
Mol. Mass.: | 20808.36 |
Organism: | Homo sapiens (Human) |
Description: | Human EphA4-LBD I67A mutant |
Residue: | 181 |
Sequence: | NEVTLLDSRSVQGELGWIASPLEGGWEEVSIMDEKNTPARTYQVCNVMEPSQNNWLRTDW
ITREGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTI
AADESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVFYKKCPLTV
R
|
|
|
BDBM223311 |
---|
n/a |
---|
Name | BDBM223311 |
Synonyms: | 123C4 |
Type | Small organic molecule |
Emp. Form. | C43H47ClN8O6 |
Mol. Mass. | 807.336 |
SMILES | COc1ccc2[nH]cc(CCNC(=O)[C@H](Cc3ccncc3)NC(=O)[C@H](Cc3ccc(Cl)cc3)NC(=O)[C@H](Cc3c[nH]c4ccc(O)cc34)NC(=O)CCCN)c2c1 |r| |
Structure |
|