Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 9A (PDE9A2)
LigandBDBM224784
Substrate/Competitorn/a
Meas. Tech.Scintillation Proximity Assay
Temperature298.15±n/a K
IC50 4±n/a nM
Commentsextracted
Citation Heine NEickmeier CFerrera MGiovannini RRosenbrock HSchaenzle G 6-cycloalkyl-pyrazolopyrimidinones for the treatment of CNS disorders US Patent  US9328120 Publication Date 5/3/2016
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 9A (PDE9A2)
Name:Phosphodiesterase 9A (PDE9A2)
Synonyms:Phosphodiesterase 9A2
Type:Protein
Mol. Mass.:61702.98
Organism:Homo sapiens (Human)
Description:O76083-2
Residue:533
Sequence:
MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLPRNTTISLLTTDDAM
VSIDPTMPANSERTPYKVRPVAIKQLSEREELIQSVLAQVAEQFSRAFKINELKAEVANH
LAVLEKRVELEGLKVVEIEKCKSDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDV
PTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLF
CVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYN
NTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLI
LATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCL
LEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIML
QPLWESRDRYEELKRIDDAMKELQKKTDSLTSGATEKSRERSRDVKNSEGDCA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM224784
n/a
NameBDBM224784
Synonyms:US9328120, 14 (enantiomer 1) | US9328120, 15 (enantiomer 2)
TypeSmall organic molecule
Emp. Form.C19H20F2N6O
Mol. Mass.386.3985
SMILESFC1(F)CCC(CC1)n1ncc2c1nc([nH]c2=O)C1CCC1c1ncccn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: