| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Uncharacterized PhzA/B-like protein PA3332 |
|---|
| Ligand | BDBM17292 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Thermofluor_Method2 |
|---|
| Kd | 19000±3350 nM |
|---|
| Citation |  D3R, DD Baker-CSAR DIG-BP D3R D3R Publication Date 7/29/2015 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Uncharacterized PhzA/B-like protein PA3332 |
|---|
| Name: | Uncharacterized PhzA/B-like protein PA3332 |
|---|
| Synonyms: | DIG-BP | Engineered Digoxigenin binder DIG10.2 | Y3332_PSEAE |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 15916.84 |
|---|
| Organism: | Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) |
|---|
| Description: | n/a |
|---|
| Residue: | 141 |
|---|
| Sequence: | MNAKEILVHSLRLLENGDARGWCDLFHPEGVLEFPYAPPGWKTRFEGRETIWAHMRLFPE
HLTVRFTDVQFYETADPDLAIGEFHGDGVATVSGGKLAQDYISVLRTRDGQILLYRDFWN
PLRHLEALGGVEAAAKIVQGA
|
|
|
|---|
| BDBM17292 |
|---|
| n/a |
|---|
| Name | BDBM17292 |
|---|
| Synonyms: | (1S,10R,11S,14S,15S)-15-methyltetracyclo[8.7.0.0^{2,7}.0^{11,15}]heptadeca-2,4,6-triene-5,14-diol | 17 beta-Estradiol | 17α-ethinylestradiol | 17beta-estradiol (E2) | CHEMBL135 | CS336 | ESTRADIOL | Estradiol-17 alpha | Ovocyclin | US9034854, E2 | US9040509, E2 | US9422324, E2 | US9561238, E2 | [2,4,6,7-3H]-17beta-estradiol | [2,4,6,7-3H]-E2 | [3H]-estradiol | [3H]]estradiol |
|---|
| Type | Steroid |
|---|
| Emp. Form. | C18H24O2 |
|---|
| Mol. Mass. | 272.382 |
|---|
| SMILES | [H][C@@]12CC[C@H](O)[C@@]1(C)CC[C@]1([H])c3ccc(O)cc3CC[C@@]21[H] |
|---|
| Structure | 
|
|---|
Search and Browse
