| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM226175 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dihydrofolate Reductase (DHFR) Inhibition Assay |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | 14700±1260 nM |
|---|
| Comments | extracted |
|---|
| Citation |  El-Gazzar, YI; Georgey, HH; El-Messery, SM; Ewida, HA; Hassan, GS; Raafat, MM; Ewida, MA; El-Subbagh, HI Synthesis, biological evaluation and molecular modeling study of new (1,2,4-triazole or 1,3,4-thiadiazole)-methylthio-derivatives of quinazolin-4(3H)-one as DHFR inhibitors Bioorg Chem72:282-292 (2017) |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DHFR | DYR_BOVIN | Dihydrofolate reductase | Dihydrofolate reductase (DHFR) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21603.71 |
|---|
| Organism: | Bos taurus (Cattle) |
|---|
| Description: | P00376 |
|---|
| Residue: | 187 |
|---|
| Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFQYFQRMTTVSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPKGAHFLAKSLDDALELIEDPELTNKVDVVWIVGGSS
VYKEAMNKPGHVRLFVTRIMQEFESDAFFPEIDFEKYKLLPEYPGVPLDVQEEKGIKYKF
EVYEKNN
|
|
|
|---|
| BDBM226175 |
|---|
| n/a |
|---|
| Name | BDBM226175 |
|---|
| Synonyms: | 6,7-Dimethoxy-2-((5-(4-chlorophenylamino)-1,3,4-thiadiazol-2-yl)methylthio)-3-(4-methoxyphenyl)quinazolin-4(3H)-one (30) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H22ClN5O4S2 |
|---|
| Mol. Mass. | 568.067 |
|---|
| SMILES | COc1ccc(cc1)-n1c(SCc2nnc(Nc3ccc(Cl)cc3)s2)nc2cc(OC)c(OC)cc2c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
