| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Androgen receptor [646-919] |
|---|
| Ligand | BDBM227645 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Fluorescence Polarization Assay |
|---|
| pH | 6.5±n/a |
|---|
| Kd | 2.0e+3± 6e+2 nM |
|---|
| Comments | extracted |
|---|
| Citation |  Jehle, K; Cato, L; Neeb, A; Muhle-Goll, C; Jung, N; Smith, EW; Buzon, V; Carbó, LR; Estébanez-Perpiñá, E; Schmitz, K; Fruk, L; Luy, B; Chen, Y; Cox, MB; Bräse, S; Brown, M; Cato, AC Coregulator control of androgen receptor action by a novel nuclear receptor-binding motif. J Biol Chem289:8839-51 (2014) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Androgen receptor [646-919] |
|---|
| Name: | Androgen receptor [646-919] |
|---|
| Synonyms: | ANDR_HUMAN | AR | Androgen receptor ligand-binding domain (AR-LBD) | DHTR | NR3C4 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 31698.13 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human AR hinge-LBD (646-919 aa) |
|---|
| Residue: | 274 |
|---|
| Sequence: | ASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSL
NELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYF
APDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQ
KFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKS
HMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT
|
|
|
|---|
| BDBM227645 |
|---|
| n/a |
|---|
| Name | BDBM227645 |
|---|
| Synonyms: | Bag-1L (1-20) | MAQRGGARRPRGDRERLGSR |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C89H160N42O27S |
|---|
| Mol. Mass. | 2282.553 |
|---|
| SMILES | CSCC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
