Reaction Details |
| Report a problem with these data |
Target | Fatty acid-binding protein 5 [M35A,L60A] |
---|
Ligand | BDBM50152850 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Ligand Binding Assay |
---|
pH | 8.2±n/a |
---|
Temperature | 303.15±n/a K |
---|
Ki | 6.9e+2±n/a nM |
---|
Comments | extracted |
---|
Citation | Armstrong, EH; Goswami, D; Griffin, PR; Noy, N; Ortlund, EA Structural basis for ligand regulation of the fatty acid-binding protein 5, peroxisome proliferator-activated receptor ß/d (FABP5-PPARß/d) signaling pathway. J Biol Chem289:14941-54 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Fatty acid-binding protein 5 [M35A,L60A] |
---|
Name: | Fatty acid-binding protein 5 [M35A,L60A] |
Synonyms: | FABP5 | FABP5_HUMAN | Fatty acid-binding protein 5 (FABP5)(DSm) |
Type: | Protein |
Mol. Mass.: | 15062.59 |
Organism: | Homo sapiens (Human) |
Description: | Human FABP5 "double-switch" mutant (M35A/L60A) |
Residue: | 135 |
Sequence: | MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKAGAMAKPDCIITCDGKNLTIKTESTA
KTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVEC
VMNNVTCTRIYEKVE
|
|
|
BDBM50152850 |
---|
n/a |
---|
Name | BDBM50152850 |
Synonyms: | 1-HEXYLDECANOIC ACID | CHEMBL82293 | Hexadecanoic acid | Hexadecanoic acid anion | Palmitic acid (PA) |
Type | Small organic molecule |
Emp. Form. | C16H32O2 |
Mol. Mass. | 256.4241 |
SMILES | CCCCCCCCCCCCCCCC(O)=O |
Structure |
|