| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Na(+)/H(+) exchange regulatory cofactor NHE-RF1 [1-140] |
|---|
| Ligand | BDBM228838 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Fluorescent Polarization Competition Assay |
|---|
| pH | 7.4±0 |
|---|
| Temperature | 296.15±0 K |
|---|
| Ki | 1.10e+4±n/a nM |
|---|
| Citation |  Mamonova, T; Zhang, Q; Chandra, M; Collins, BM; Sarfo, E; Bu, Z; Xiao, K; Bisello, A; Friedman, PA Origins of PDZ Binding Specificity. A Computational and Experimental Study Using NHERF1 and the Parathyroid Hormone Receptor. Biochemistry56:2584-2593 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Na(+)/H(+) exchange regulatory cofactor NHE-RF1 [1-140] |
|---|
| Name: | Na(+)/H(+) exchange regulatory cofactor NHE-RF1 [1-140] |
|---|
| Synonyms: | NHERF | NHERF1 | NHRF1_HUMAN | Na+/H+ exchanger regulatory factor-1 PDZ domain (PDZ1) | SLC9A3R1 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 14899.03 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | PDZ1 domain of human NHERF1 (1-140 aa) |
|---|
| Residue: | 140 |
|---|
| Sequence: | MSADAAAGAPLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLV
EVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQLQKLGVQVREELLRAQEAPGQA
EPPAAAEVQGAGNENEPREA
|
|
|
|---|
| BDBM228838 |
|---|
| n/a |
|---|
| Name | BDBM228838 |
|---|
| Synonyms: | Cys-PTHRct-9 | LQEEWECVM |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C50H75N11O17S2 |
|---|
| Mol. Mass. | 1166.324 |
|---|
| SMILES | CSCC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CS)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CC(C)C)C(C)C)C(O)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
