| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Platelet-derived growth factor subunit B |
|---|
| Ligand | BDBM234588 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Kinase Assay |
|---|
| pH | 7.4±n/a |
|---|
| IC50 | 23±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Boral, S; Malone, TC; Wang, S Indole-1-carboxamides as kinase inhibitors US Patent US9353093 Publication Date 5/31/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Platelet-derived growth factor subunit B |
|---|
| Name: | Platelet-derived growth factor subunit B |
|---|
| Synonyms: | PDGF | PDGF2 | PDGFB | PDGFB_HUMAN | Platelet-derived growth factor subunit B | Platelet-derived growth factor subunit B (PDGFB) | SIS |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 27298.80 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P01127 |
|---|
| Residue: | 241 |
|---|
| Sequence: | MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAEL
DLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLV
WPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKC
ETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLG
A
|
|
|
|---|
| BDBM234588 |
|---|
| n/a |
|---|
| Name | BDBM234588 |
|---|
| Synonyms: | US9353093, 10 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H18N4O2 |
|---|
| Mol. Mass. | 370.4039 |
|---|
| SMILES | NC(=O)n1c(cc2ccccc12)-c1ccc(NC(=O)Nc2ccccc2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
