| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tumor necrosis factor |
|---|
| Ligand | BDBM235320 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ELISA Assay |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | 1000±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Mjalli, AM; Gaddam, B; Polisetti, DR; Kostura, MJ; Guzel, M Tricyclic compounds as modulators of TNF-alpha synthesis and as PDE4 inhibitors US Patent US9393245 Publication Date 7/19/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tumor necrosis factor |
|---|
| Name: | Tumor necrosis factor |
|---|
| Synonyms: | Cachectin | TNF | TNF-a | TNF-alpha | TNFA | TNFA_HUMAN | TNFSF2 | Tumor necrosis factor (TNF-alpha) | Tumor necrosis factor (TNFa) | Tumor necrosis factor alpha (TNFα) | Tumor necrosis factor ligand superfamily member 2 | Tumor necrosis factor, membrane form | Tumor necrosis factor, soluble form | tumor necrosis factor alpha |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 25645.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P01375 |
|---|
| Residue: | 233 |
|---|
| Sequence: | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
|
|
|
|---|
| BDBM235320 |
|---|
| n/a |
|---|
| Name | BDBM235320 |
|---|
| Synonyms: | US10085990, Example 46 | US9393245, 46 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H23N3O5 |
|---|
| Mol. Mass. | 397.4244 |
|---|
| SMILES | CCOC(=O)Cn1c(=O)n(C2CCCC2)c2c3cccc(OC)c3ncc2c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
