| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mineralocorticoid receptor [729-984] |
|---|
| Ligand | BDBM238163 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Binding Assay |
|---|
| pH | 7.5±n/a |
|---|
| IC50 | 13±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  O'Mahony, G; Kossenjans, M; Edman, K; Kajanus, J; Hogner, KA; Cornwall, P; Turner, A Benzoxazinone amides as mineralocorticoid receptor modulators US Patent US9394291 Publication Date 7/19/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mineralocorticoid receptor [729-984] |
|---|
| Name: | Mineralocorticoid receptor [729-984] |
|---|
| Synonyms: | MCR | MCR_HUMAN | MLR | Mineralocorticoid receptor (MR) | Mineralocorticoid receptor(MR)( (T729-K985) | NR3C2 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 29747.25 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | amino acids T729-K985 |
|---|
| Residue: | 256 |
|---|
| Sequence: | TISRALTPSPVMVLENIEPEIVYAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLP
GFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYEL
CQGMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYIKELRKMVT
KCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESHALKVEFPAMLVEIISDQL
PKVESGNAKPLYFHRK
|
|
|
|---|
| BDBM238163 |
|---|
| n/a |
|---|
| Name | BDBM238163 |
|---|
| Synonyms: | US10017502, Example 6 | US9394291, 6 | US9394291, 6a | US9394291, 6b |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H18ClN3O5 |
|---|
| Mol. Mass. | 415.827 |
|---|
| SMILES | CNC(=O)CC1COc2cc(Cl)ccc2N1C(=O)c1ccc2OCC(=O)Nc2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
