Reaction Details |
| Report a problem with these data |
Target | Beta-carbonic anhydrase 1 |
---|
Ligand | BDBM11622 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | CA Inhibition Assay |
---|
pH | 8.3±0 |
---|
Temperature | 298.15±0 K |
---|
Ki | 2.9e+2±n/a nM |
---|
Citation | Maresca, A; Scozzafava, A; Vullo, D; Supuran, CT Dihalogenated sulfanilamides and benzolamides are effective inhibitors of the three ß-class carbonic anhydrases from Mycobacterium tuberculosis. J Enzyme Inhib Med Chem28:384-7 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Beta-carbonic anhydrase 1 |
---|
Name: | Beta-carbonic anhydrase 1 |
Synonyms: | β-Carbonic anhydrase 1 (CA 1) | Carbonic Anhydrase (mtCA 1) | MTCA1_MYCTU | Uncharacterized protein Rv1284/MT1322 | canA | mtcA1 |
Type: | Enzyme |
Mol. Mass.: | 18186.06 |
Organism: | Mycobacterium tuberculosis |
Description: | The recombinant GST-mtCA1 construct was cloned, expressed, and further purified from E. coli. The purified protein was used in inhibition assays. |
Residue: | 163 |
Sequence: | MTVTDDYLANNVDYASGFKGPLPMPPSKHIAIVACMDARLDVYRMLGIKEGEAHVIRNAG
CVVTDDVIRSLAISQRLLGTREIILLHHTDCGMLTFTDDDFKRAIQDETGIRPTWSPESY
PDAVEDVRQSLRRIEVNPFVTKHTSLRGFVFDVATGKLNEVTP
|
|
|
BDBM11622 |
---|
n/a |
---|
Name | BDBM11622 |
Synonyms: | β-CA inhibitor, 1 | 2-N-(4-amino-3-chlorobenzene)-1,3,4-thiadiazole-2,5-disulfonamide | 5-(4-Amino-3-chlorobenzenesulfonamido)-1,3,4-thiadiazole-2-sulfonamide | aminobenzolamide 17c |
Type | Small organic molecule |
Emp. Form. | C8H8ClN5O4S3 |
Mol. Mass. | 369.828 |
SMILES | Nc1ccc(cc1Cl)S(=O)(=O)Nc1nnc(s1)S(N)(=O)=O |
Structure |
|