Reaction Details |
| Report a problem with these data |
Target | E3 ubiquitin-protein ligase XIAP [124-240] |
---|
Ligand | BDBM240883 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | TR-FRET Assay |
---|
pH | 7.5±n/a |
---|
Temperature | 298.15±n/a K |
---|
IC50 | 0.429±n/a nM |
---|
Comments | extracted |
---|
Citation | Mischke, SG Dimeric compounds US Patent US9409888 Publication Date 8/9/2016 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
E3 ubiquitin-protein ligase XIAP [124-240] |
---|
Name: | E3 ubiquitin-protein ligase XIAP [124-240] |
Synonyms: | API3 | BIRC4 | Baculoviral IAP repeat-containing protein 2 (BIR2) | E3 ubiquitin-protein ligase XIAP (BIR2) | E3 ubiquitin-protein ligase XIAP BIR2 | IAP3 | XIAP | XIAP protein BIR2 | XIAP_HUMAN |
Type: | Protein |
Mol. Mass.: | 13562.46 |
Organism: | Artificial Sequence |
Description: | TR-FRET peptide Corresponds to amino acids 124-240 of human XIAP. |
Residue: | 117 |
Sequence: | RDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLTPRE
LASAGLYYTGIGDQVQCFACGGKLKNWEPGDRAWSEHRRHFPNCFFVLGRNLNIRSE
|
|
|
BDBM240883 |
---|
n/a |
---|
Name | BDBM240883 |
Synonyms: | US9409888, 23 |
Type | Small organic molecule |
Emp. Form. | C58H58N8O6 |
Mol. Mass. | 963.1311 |
SMILES | CN[C@@H](C)C(=O)N[C@H]1CN(C(=O)c2ccc(cc2)C(=O)N2C[C@H](NC(=O)[C@H](C)NC)C(=O)N(Cc3c(C)ccc4ccccc34)c3ccccc23)c2ccccc2N(Cc2c(C)ccc3ccccc23)C1=O |
Structure |
|