| Reaction Details |
|---|
 | Report a problem with these data |
| Target | E3 ubiquitin-protein ligase XIAP [124-240] |
|---|
| Ligand | BDBM240897 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | TR-FRET Assay |
|---|
| pH | 7.5±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | 0.8715±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Mischke, SG Dimeric compounds US Patent US9409888 Publication Date 8/9/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| E3 ubiquitin-protein ligase XIAP [124-240] |
|---|
| Name: | E3 ubiquitin-protein ligase XIAP [124-240] |
|---|
| Synonyms: | API3 | BIRC4 | Baculoviral IAP repeat-containing protein 2 (BIR2) | E3 ubiquitin-protein ligase XIAP (BIR2) | E3 ubiquitin-protein ligase XIAP BIR2 | IAP3 | XIAP | XIAP protein BIR2 | XIAP_HUMAN |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 13562.46 |
|---|
| Organism: | Artificial Sequence |
|---|
| Description: | TR-FRET peptide Corresponds to amino acids 124-240 of human XIAP. |
|---|
| Residue: | 117 |
|---|
| Sequence: | RDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLTPRE
LASAGLYYTGIGDQVQCFACGGKLKNWEPGDRAWSEHRRHFPNCFFVLGRNLNIRSE
|
|
|
|---|
| BDBM240897 |
|---|
| n/a |
|---|
| Name | BDBM240897 |
|---|
| Synonyms: | US9409888, 18 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C58H64Br2N8O8 |
|---|
| Mol. Mass. | 1160.986 |
|---|
| SMILES | CN[C@@H](C)C(=O)N[C@H]1CN(C(=O)CCCCCCC(=O)N2C[C@H](NC(=O)[C@H](C)NC)C(=O)N(Cc3c(OC)ccc4cc(Br)ccc34)c3ccccc23)c2ccccc2N(Cc2c(OC)ccc3cc(Br)ccc23)C1=O |
|---|
| Structure | 
|
|---|
Search and Browse
