Reaction Details |
| Report a problem with these data |
Target | Genome polyprotein |
---|
Ligand | BDBM241941 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | FRET Assay |
---|
pH | 7.8±n/a |
---|
Temperature | 298.15±n/a K |
---|
IC50 | 53±n/a nM |
---|
Comments | extracted |
---|
Citation | Niu, D; Petter, RC; Qiao, L; Singh, J HCV protease inhibitors and uses thereof US Patent US9422333 Publication Date 8/23/2016 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Genome polyprotein |
---|
Name: | Genome polyprotein |
Synonyms: | Protease NS3/Non-structural protein 4A (NS3/NS4A) | Protease NS3/Non-structural protein 4A (NS3/NS4A) (D168V) |
Type: | Enzyme |
Mol. Mass.: | 19121.30 |
Organism: | Hepatitis C virus genotype 1b (isolate Con1) (HCV) |
Description: | Q91RS4 |
Residue: | 181 |
Sequence: | APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTAAQTFLATCINGVCWTVYHGAG
TRTIASPKGPVIQMYTNVDQDLVGWPAPQGARSLTPCTCGSSDLYLVTRHADVIPVRRRG
DSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMR
S
|
|
|
BDBM241941 |
---|
n/a |
---|
Name | BDBM241941 |
Synonyms: | US9422333, I-6 |
Type | Small organic molecule |
Emp. Form. | C30H46N4O7 |
Mol. Mass. | 574.7088 |
SMILES | [#6]\[#6](-[#6])=[#6]\[#6](=O)-[#6]-[#6]-[#6@H](-[#7]-[#6](=O)-[#8]C([#6])([#6])[#6])-[#6](=O)-[#7]-1-[#6]-[#6]2-[#6@@H](-[#6@H]-1-[#6](=O)-[#7]-[#6](-[#6]-[#6]-1-[#6]-[#6]-[#6]-1)-[#6](=O)-[#6](-[#7])=O)C2([#6])[#6] |r,w:27.28| |
Structure |
|