Reaction Details |
| Report a problem with these data |
Target | Genome polyprotein [1027-1207,A156S] |
---|
Ligand | BDBM241940 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | FRET Assay |
---|
pH | 7.5±n/a |
---|
IC50 | >3000±n/a nM |
---|
Comments | extracted |
---|
Citation | Niu, D; Petter, RC; Qiao, L; Singh, J HCV protease inhibitors and uses thereof US Patent US9422333 Publication Date 8/23/2016 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Genome polyprotein [1027-1207,A156S] |
---|
Name: | Genome polyprotein [1027-1207,A156S] |
Synonyms: | POLG_HCV1 | Protease NS3/Non-structural protein 4A (NS3/NS4A) (A156S) |
Type: | Enzyme |
Mol. Mass.: | 19137.30 |
Organism: | Hepatitis C virus genotype 1b (isolate Con1) (HCV) |
Description: | P26664[1027-1207,A156S] |
Residue: | 181 |
Sequence: | APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTAAQTFLATCINGVCWTVYHGAG
TRTIASPKGPVIQMYTNVDQDLVGWPAPQGARSLTPCTCGSSDLYLVTRHADVIPVRRRG
DSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRSAVCTRGVAKAVDFIPVENLETTMR
S
|
|
|
BDBM241940 |
---|
n/a |
---|
Name | BDBM241940 |
Synonyms: | US9422333, I-1 |
Type | Small organic molecule |
Emp. Form. | C27H42N6O6 |
Mol. Mass. | 546.659 |
SMILES | CC(C)(C)NC(=O)N[C@@H](CNC(=O)C=C)C(=O)N1CC2[C@@H]([C@H]1C(=O)NC(CC1CCC1)C(=O)C(N)=O)C2(C)C |r,w:25.26| |
Structure |
|