| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Genome polyprotein [1027-1207,R155K] |
|---|
| Ligand | BDBM241941 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | FRET Assay |
|---|
| pH | 7.5±n/a |
|---|
| IC50 | 1050±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Niu, D; Petter, RC; Qiao, L; Singh, J HCV protease inhibitors and uses thereof US Patent US9422333 Publication Date 8/23/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Genome polyprotein [1027-1207,R155K] |
|---|
| Name: | Genome polyprotein [1027-1207,R155K] |
|---|
| Synonyms: | POLG_HCV1 | Protease NS3/Non-structural protein 4A (NS3/NS4A) (R155K) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 19093.28 |
|---|
| Organism: | Hepatitis C virus genotype 1b (isolate Con1) (HCV) |
|---|
| Description: | P26664[1027-1207,R155K] |
|---|
| Residue: | 181 |
|---|
| Sequence: | APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTAAQTFLATCINGVCWTVYHGAG
TRTIASPKGPVIQMYTNVDQDLVGWPAPQGARSLTPCTCGSSDLYLVTRHADVIPVRRRG
DSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFKAAVCTRGVAKAVDFIPVENLETTMR
S
|
|
|
|---|
| BDBM241941 |
|---|
| n/a |
|---|
| Name | BDBM241941 |
|---|
| Synonyms: | US9422333, I-6 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H46N4O7 |
|---|
| Mol. Mass. | 574.7088 |
|---|
| SMILES | [#6]\[#6](-[#6])=[#6]\[#6](=O)-[#6]-[#6]-[#6@H](-[#7]-[#6](=O)-[#8]C([#6])([#6])[#6])-[#6](=O)-[#7]-1-[#6]-[#6]2-[#6@@H](-[#6@H]-1-[#6](=O)-[#7]-[#6](-[#6]-[#6]-1-[#6]-[#6]-[#6]-1)-[#6](=O)-[#6](-[#7])=O)C2([#6])[#6] |r,w:27.28| |
|---|
| Structure | 
|
|---|
Search and Browse
