Reaction Details |
| Report a problem with these data |
Target | Interstitial collagenase [100-268] |
---|
Ligand | BDBM7462 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | cd-MMP-1 Activity Assay |
---|
pH | 7.5±n/a |
---|
IC50 | 1.35e+3±n/a nM |
---|
Comments | extracted |
---|
Citation | Lu, W; Zhu, J; Zou, S; Li, X; Huang, J The efficient expression of human fibroblast collagenase in Escherichia coli and the discovery of flavonoid inhibitors. J Enzyme Inhib Med Chem28:741-6 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Interstitial collagenase [100-268] |
---|
Name: | Interstitial collagenase [100-268] |
Synonyms: | CLG | MMP1 | MMP1_HUMAN | Matrix metalloproteinase-1 (cd-MMP-1) |
Type: | Enzyme |
Mol. Mass.: | 18886.85 |
Organism: | Homo sapiens (Human) |
Description: | Catalytic domain of human MMP-1 (100-268 aa) |
Residue: | 169 |
Sequence: | FVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADI
MISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHE
LGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQ
|
|
|
BDBM7462 |
---|
n/a |
---|
Name | BDBM7462 |
Synonyms: | 3,5,7-trihydroxy-2-(4-hydroxyphenyl)-4H-chromen-4-one | 3,5,7-trihydroxy-2-(4-hydroxyphenyl)-chromen-4-one | CHEMBL150 | Kaempferol (18) | Kaempferol (Kmp) | cid_5280863 | kaempferol |
Type | Small organic molecule |
Emp. Form. | C15H10O6 |
Mol. Mass. | 286.2363 |
SMILES | Oc1ccc(cc1)-c1oc2cc(O)cc(O)c2c(=O)c1O |
Structure |
|