| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Amyloid-beta precursor protein [672-711] |
|---|
| Ligand | BDBM250505 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Electrochemiluminescence (ECL)-Based Immunoassay |
|---|
| pH | 7±n/a |
|---|
| IC50 | 5.4±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Pissarnitski, D; Zhao, Z Spirocyclic sulfones as gamma secretase inhibitors US Patent US9464103 Publication Date 10/11/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Amyloid-beta precursor protein [672-711] |
|---|
| Name: | Amyloid-beta precursor protein [672-711] |
|---|
| Synonyms: | A4 | A4_HUMAN | AD1 | APP | Beta-amyloid protein 40 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 4328.29 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | aa 672-711 |
|---|
| Residue: | 40 |
|---|
| Sequence: | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
|
|
|
|---|
| BDBM250505 |
|---|
| n/a |
|---|
| Name | BDBM250505 |
|---|
| Synonyms: | US9464103, (6aR,7S,10aS)-10a-(4-chlorobenzenesulfonyl)-1,4-difluoro-7'-methyl-6,6a,8,9,10,10a-hexahydrospiro[benzo[c]isochromene-7,3'-[1,6,7λ⁵]dioxaphosphepane]-7'-one |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H24ClF2O6PS |
|---|
| Mol. Mass. | 532.922 |
|---|
| SMILES | CP1(=O)OCC[C@]2(CCC[C@@]3([C@H]2COc2c(F)ccc(F)c32)S(=O)(=O)c2ccc(Cl)cc2)CO1 |r,w:1.0| |
|---|
| Structure | 
|
|---|
Search and Browse
