Reaction Details |
| Report a problem with these data |
Target | Alpha-carbonic anhydrase |
---|
Ligand | BDBM50278312 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_158306 (CHEMBL763191) |
---|
pH | 7.5±n/a |
---|
Temperature | 293.15±n/a K |
---|
Ki | 550000±n/a nM |
---|
Citation | Del Prete, S; Vullo, D; De Luca, V; Carginale, V; di Fonzo, P; Osman, SM; AlOthman, Z; Supuran, CT; Capasso, C Anion inhibition profiles of a-, ß- and ¿-carbonic anhydrases from the pathogenic bacterium Vibrio cholerae. Bioorg Med Chem24:3413-7 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Alpha-carbonic anhydrase |
---|
Name: | Alpha-carbonic anhydrase |
Synonyms: | hpαCA |
Type: | Protein |
Mol. Mass.: | 28337.60 |
Organism: | Helicobacter pylori (strain G27) |
Description: | B5Z8I0 |
Residue: | 247 |
Sequence: | MKKTFLIALALTASLIGAENAKWDYKNKENGPHRWDKLHKDFEVCKSGKSQSPINIEHYY
HTQDKADLQFKYAASKPKAVFFTHHTLKASFEPTNHINYRGHDYVLDNVHFHAPMEFLIN
NKTRPLSAHFVHKDAKGRLLVLAIGFEEGKENPNLDPILEGIQKKQNFKEVALDAFLPKS
INYYHFNGSLTAPPCTEGVAWFVVEEPLEVSAKQLAEIKKRMKNSPNQRPVQPDYNTVII
KRSAETR
|
|
|
BDBM50278312 |
---|
n/a |
---|
Name | BDBM50278312 |
Synonyms: | CHEMBL445433 | sodium stannate(IV) |
Type | Small organic molecule |
Emp. Form. | O3Sn |
Mol. Mass. | 166.71 |
SMILES | [O-][Sn]([O-])=O |
Structure |
|