| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase |
|---|
| Ligand | BDBM50010231 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_158307 (CHEMBL763192) |
|---|
| pH | 7.5±n/a |
|---|
| Temperature | 293.15±n/a K |
|---|
| Ki | 43000±n/a nM |
|---|
| Citation |  Del Prete, S; Vullo, D; De Luca, V; Carginale, V; di Fonzo, P; Osman, SM; AlOthman, Z; Supuran, CT; Capasso, C Anion inhibition profiles of a-, ß- and ¿-carbonic anhydrases from the pathogenic bacterium Vibrio cholerae. Bioorg Med Chem24:3413-7 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Carbonic anhydrase |
|---|
| Name: | Carbonic anhydrase |
|---|
| Synonyms: | VchCA |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 26434.13 |
|---|
| Organism: | Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) |
|---|
| Description: | Q9KMP6 |
|---|
| Residue: | 239 |
|---|
| Sequence: | MKKTTWVLAMVASMSFGVQASEWGYEGEHAPEHWGKVAPLCAEGKNQSPIDVAQSVEADL
QPFTLNYQGQVVGLLNNGHTLQAIVRGNNPLQIDGKTFQLKQFHFHTPSENLLKGKQFPL
EAHFVHADEQGNLAVVAVMYQVGSENPLLKVLTADMPTKGNSTQLTQGIPLADWIPESKH
YYRFNGSLTTPPCSEGVRWIVLKEPAHLSNQQEQQLSAVMGHNNRPVQPHNARLVLQAD
|
|
|
|---|
| BDBM50010231 |
|---|
| n/a |
|---|
| Name | BDBM50010231 |
|---|
| Synonyms: | CHEMBL107217 | Ditiocarb sodium | Sodium salt of Diethyl-dithiocarbamic acid(DDC) | US9180183, DDTC | sodium N,N-diethyl-dithiocarbamate | sodium diethyldithiocarbamate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C5H10NS2 |
|---|
| Mol. Mass. | 148.27 |
|---|
| SMILES | CCN(CC)C([S-])=S |
|---|
| Structure | 
|
|---|
Search and Browse
